PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_25800A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family E2F/DP
Protein Properties Length: 79aa    MW: 9389.91 Da    PI: 9.5108
Description E2F/DP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_25800AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1E2F_TDP53.83.1e-176383871
                    E2F_TDP 38 dvknkrRRiYDilNVLealnliekkekneirwkg 71
                               d+kn+rRR+YD+lNVL+a+++i+k +k+ei+wkg
  Oropetium_20150105_25800A  6 DEKNIRRRVYDALNVLMAMEIISK-DKKEIQWKG 38
                               789*********************.*******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM013725.3E-4138IPR003316E2F/DP family, winged-helix DNA-binding domain
Gene3DG3DSA:1.10.10.102.9E-23244IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.9E-12339IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF023197.6E-15338IPR003316E2F/DP family, winged-helix DNA-binding domain
SuperFamilySSF1440744.71E-54575No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005667Cellular Componenttranscription factor complex
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MQQQYDEKNI RRRVYDALNV LMAMEIISKD KKEIQWKGLP RTSMDEIDEL KTEIMGMKGR  60
IEKKSAYLQD LQDQLRQK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1cf7_B4e-175435593PROTEIN (TRANSCRIPTION FACTOR DP-2)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0365665e-63BT036566.1 Zea mays full-length cDNA clone ZM_BFb0123L22 mRNA, complete cds.
GenBankBT0410805e-63BT041080.1 Zea mays full-length cDNA clone ZM_BFc0172H21 mRNA, complete cds.
GenBankEU9752755e-63EU975275.1 Zea mays clone 486268 transcription factor Dp-1 mRNA, complete cds.
GenBankHQ8587675e-63HQ858767.1 Zea mays clone UT1683 E2F-DP transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150052.15e-40uncharacterized protein LOC100283679
SwissprotQ9FNY22e-32DPB_ARATH; Transcription factor-like protein DPB
TrEMBLB6TKJ85e-40B6TKJ8_MAIZE; Transcription factor Dp-1
TrEMBLM0Z8R74e-40M0Z8R7_HORVD; Uncharacterized protein
STRINGMLOC_79152.21e-39(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128338109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03415.27e-34Transcription factor DP